PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0040600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 241aa    MW: 25646.1 Da    PI: 4.9102
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0040600.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.53.1e-135090446
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        +  E e ++ + k+lG++ W+ Ia++m+ gRt++++k++w++
  ORGLA01G0040600.1 50 ISDREAETIISLQKLLGNR-WSVIAAKMP-GRTDNEIKNYWNS 90
                       577899*************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.726441IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.8E-71544IPR009057Homeodomain-like
SuperFamilySSF466893.38E-192797IPR009057Homeodomain-like
PROSITE profilePS5129420.5524296IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.9E-224595IPR009057Homeodomain-like
SMARTSM007173.8E-124694IPR001005SANT/Myb domain
CDDcd001671.99E-94989No hitNo description
PfamPF002498.1E-115190IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
NXLLHRXFGF SIXQGWHCIC VNCAGLRRSG KSCRLRWMNY LRPDLKKEPI SDREAETIIS  60
LQKLLGNRWS VIAAKMPGRT DNEIKNYWNS RIRKRQSAAA GSGGCPTPGT VMEKEPTANA  120
ATVAAAPEAA SPPPPPIPAR LPMFSCQLLD GGGGGAATTQ SPPNAGSSDI SEVSACGGNG  180
GGEDSSRDYC FSGGDVDGDG DMVHLLALDD LDLLVDVPGL LDVDAWDCEL YRADYSTSSS  240
M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-19149528107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0029120.0AP002912.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0028E10.
GenBankAP0033390.0AP003339.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OJ1276_B06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAY4593430.0AY459343.1 Oryza sativa (japonica cultivar-group) clone CL018501.1 R2R3-MYB gene region.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694952.11e-100PREDICTED: myb-related protein Hv33-like
TrEMBLI1NKL61e-175I1NKL6_ORYGL; Uncharacterized protein
STRINGORGLA01G0040600.11e-175(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.15e-31myb domain protein 74